LRG1 anticorps (N-Term)

N° du produit ABIN633085

Cet anticorps Lapin Polyclonal détecte spécifiquement LRG1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour LRG1 anticorps (N-Term) (ABIN633085)

Antigène: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRG1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LRG1 anticorps

Épitope: N-Term

Specificité: LRG1 antibody was raised against the N terminal of LRG1

Purification: Affinity purified

Immunogène: LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRG1 Blocking Peptide, (ABIN939043), is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRG1

Antigène: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Autre désignation: LRG1

Sujet: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation